—- China Composite Output and New OrdersBothFallforFirst Time inSevenMonths // Mish’s Global EconomicTrendAnalysis Sings of a global slowdown continue. The HSBC China ServicesPMI shows China Composite Output and New Orders Both Fall for First Time in Seven Months. HSBC China Composite PMI ™ data (which covers both manufacturing and services) signalled a contraction of private sector output in China, following a six-month sequence of growth. … Seguir leyendo China Composite Output and New Orders Both Fall for First Time in Seven Months

—- Stiglitz: Leavingthe Euro PainfulbutStayingin More Painful; EurozoneBreakupRecap // Mish’s Global EconomicTrendAnalysis Nobel prize winning economist Joseph E. Stiglitz has come to the right conclusion [youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI][youtube http://youtube.com/w/?v=6FzI-5baKsI]. Question: I want to probe you a bit on that small mistake of the euro. UYou seem to suggest there is nothing that cannot be solved with more European solidarity … Seguir leyendo Stiglitz: Leaving the Euro Painful but Staying in More Painful; Eurozone Breakup Recap

—- UkraineImposes Capital Controls, LimitsForeignCurrencyWithdrawals // ZeroHedge Yesterday wereportedthat as part of the Ukrainian central bank’s plan to bailout the nation’s largely insolvent private banks, it would provide any needed funding but only "if they will remain under open control of the National Bank of Ukraine." And since the new CB head Stepan Kubiv’s allegiance to Europe were already well-known, this was merely a quick … Seguir leyendo Ukraine Imposes Capital Controls, Limits Foreign Currency Withdrawals

—- UkraineActingPresidentSaysRussia Has InvadedUkraine, As 2000 RussianTroops, MilitaryJetsArrive // ZeroHedge Here we go: UKRAINEACTINGPRESIDENTTURCHYNOVSTARTSBRIEFINGUKRAINELEADERSAYSRUSSIASTARTSAGGRESSIONAGAINSTCOUNTRYUKRAINESAYSRUSSIAINVADEDUKRAINEUNDER GUISE OFEXERCISEUKRAINELEADERSAYSRUSSIATRYINGTOPROVOKECONFLICTUKRAINELEADERSAYSRUSSIASEEKINGTOANNEXCRIMEAUKRAINE’STURCHYNOVSAYSWILLDEFENDITSINDEPENDENCEUKRAINEACTINGPRESIDENTACCUSESRUSSIAOFWORKINGON A SCENARIOLIKEBEFOREWARWITHGEORGIA More from Interpretermag.com: “Under the guise of military exercises, Russia has brought troops into the Autonomous Republic of Crimea. And not only have they seized the parliament of the Crimea, the Council of Ministers of the Crimea, they are trying to take civilian buildings under control, communications, … Seguir leyendo Ukraine Acting President Says Russia Has Invaded Ukraine, As 2000 Russian Troops, Military Jets Arrive

—- MorganStanleyWarnsOf "Real Pain" IfChineseCurrencyKeepsDevaluing // ZeroHedge The seemingly incessant strengthening trend of the Chinese Yuan (much as with the seemingly inexorable rise of US equities or home prices) has encouraged hugeamountsofstructuredproductsto be createdoverthepastfewyearsenablingtraderstopositionfor more ofthesameinincreasinglyleveredways. That was all going great until the last few weeks which has seen China enter the currency wars (as we explained here). The problem, among many facing China, is … Seguir leyendo Morgan Stanley Warns Of “Real Pain” If Chinese Currency Keeps Devaluing

—- RussiaRespondsToUSWarning: ExpandsMilitaryPresenceGlobally // ZeroHedge Shortly after the US warned Russia over its "provocative actions" with regard Ukraine… *KERRY: RUSSIAMILITARYMOVEONUKRAINEWOULD BE GRAVE MISTAKE RiaNovostireports defenseminister Sergei ShoigusayingRussiaplans "toexpandpermanentmilitarypresenceoutsideitsbordersbyplacingmilitary bases in a numberofforeigncountries," including Vietnam, Cuba, Venezuela, Nicaragua, the Seychelles, and Singapore. "The talks are under way, and we are close to signing the relevant documents," Shoigu told reporters in Moscow. ViaRiaNovosti, Russiaisplanningtoexpanditspermanentmilitarypresenceoutsideitsbordersbyplacingmilitary bases in a … Seguir leyendo Russia Responds To US Warning: Expands Military Presence Globally

—- BankRunFull Frontal: UkrainiansWithdrew 7% OfAllDepositsInTwoDays // ZeroHedge Well that escalated quickly. It seems the ouster of Yanukovych, heralded by so many in the West as a positive, has done nothing to quell the fear of further economic collapse in Ukraine: *UKRAINIANSWITHDREW AS MUCH AS 7% OFDEPOSITS FEB. 18-20: KUBIV*DEPOSITWITHDRAWALSSTILLHIGHINTHEEAST, KUBIVSAYS This is around a 30 billion Hyrvnia loss (over $3 billion) in just 2 … Seguir leyendo Bank Run Full Frontal: Ukrainians Withdrew 7% Of All Deposits In Two Days

—- UkraineCurrencyCrashesToRecordLow // ZeroHedge Russia’searlier "default" warning (orthreat) has not just impacted Ukrainian bonds but the currency is crashing. TheHyrvniaisdown a stunning 6.8% today – thebiggestdropsince Feb 2009 – to a recordlow 9.8 totheUSDollar. This crisis is far from over and we would expect capital controls in 3…2…1… —- Shared via myfeedlyreader Seguir leyendo Ukraine Currency Crashes To Record Low

—- BeginningoftheEnd? OilCompaniesCutBackonSpending // OurFiniteWorld Steve Kopits recentlygave a presentation explaining our current predicament: the cost of oil extraction has been rising rapidly (10.9% per year) but oil prices have been flat. Major oil companies are finding their profits squeezed, and have recently announced plans to sell off part of their assets in order to have funds to pay their dividends. Such an approach is … Seguir leyendo Beginning of the End? Oil Companies Cut Back on Spending

—- CrushingThe "USIsDecoupling" Meme (InOne Simple Chart) // ZeroHedge With US equity markets hitting fresh all-time highs (as much of the rest of the world is 10-15% off its highs and falling), thememethat rules the "commonknowledge" talking-headworldis "USdecoupling" oryetanotherversionof ‘cleanestdirtyshirt’. Well, as much as we hate to steal the jam from many an asset-gatherer’s donut, the BIS provides us with a simple quick efficient guide … Seguir leyendo Crushing The “US Is Decoupling” Meme (In One Simple Chart)